PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00002.1.g03010.1.es.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 352aa    MW: 39039.1 Da    PI: 7.1259
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00002.1.g03010.1.es.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1101.2e-3447101155
                         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                     kprl+WtpeLHerFveav+qLGG++kAtPkti++lm+v+gLtl+h+kSHLQkYRl
  Zjn_sc00002.1.g03010.1.es.mkhc  47 KPRLKWTPELHERFVEAVNQLGGPDKATPKTIMRLMGVPGLTLYHLKSHLQKYRL 101
                                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.30244104IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-3345102IPR009057Homeodomain-like
SuperFamilySSF466893.05E-1846102IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-2447102IPR006447Myb domain, plants
PfamPF002498.9E-1149100IPR001005SANT/Myb domain
PfamPF143793.2E-25149195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MYHHQQQLQS HSHFLSSRQT FPPERHLLLQ GGGVPSETGL VLSTDAKPRL KWTPELHERF  60
VEAVNQLGGP DKATPKTIMR LMGVPGLTLY HLKSHLQKYR LSKNVHAQAN GGNAKNVVSC  120
TMAMDKPPEG NGSQGSHLNL GAQTNKSVHI GEALQMQIEV QRRLHEQLEV QRHLQLRIEA  180
QGKYLQSVLE KAQETLARQN AGSVGLETAK MQLSELVSKV STECLQHAFT GFEEIDGSQM  240
LQGHTMQLGD GSVDSCLTAC DESQKDQDIL SISLSAHKGK QMAFDTLAKG RISEDLFLDK  300
LSRTPPNHQE MRERRDDLSM SCQAANLDLN INDANDGPQN CKKLDLNGFS WA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984520.10.0PREDICTED: uncharacterized protein LOC101781076
TrEMBLA0A0A9CY080.0A0A0A9CY08_ARUDO; Uncharacterized protein
STRINGSi036390m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35743879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-102G2-like family protein